Did you know that you can buy products from over 140 different suppliers from us?

Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC) (N-Term) antibody

Details for Product No. ABIN310148
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
5-HT, AADC, CG10697, DDC, DdcDm, Dmel\\CG10697, ddc, fDDC, l(2)37Bl, l(2)37Ch, l(2)k02104, AMD-r, CG10501, CG17345, Dmel\\CG10501, X04695, fAMD, l(2)37Bk, l(2)amd, l(2)amd alpha-methyldopa hypersensit ... show more
5-HT, AADC, CG10697, DDC, DdcDm, Dmel\\CG10697, ddc, fDDC, l(2)37Bl, l(2)37Ch, l(2)k02104, AMD-r, CG10501, CG17345, Dmel\\CG10501, X04695, fAMD, l(2)37Bk, l(2)amd, l(2)amd alpha-methyldopa hypersensitive, l(2)amd[H], Ddc, DdcDv, Dvir\\GJ17995, GJ17995, dvir_GLEANR_2561, wu:fa56d05, wu:fd59h03, wu:fk20h01, zgc:65801, zgc:76929, Aadc show less
Epitope
N-Term
(18), (7), (7), (6), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Pig (Porcine), Human
(68), (32), (22), (18), (11), (9), (9), (9), (2), (2), (1)
Host
Rabbit
(58), (8), (8), (6), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(69), (26), (13), (10), (9), (9), (7), (4), (3), (3), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310148
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DDC
Sequence EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPA AAPQEPDTFE
Predicted Reactivity African clawed frog : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Bovine : 90 %, Pig : 90 %, Rabbit : 90 %, Rat : 90 %, Zebrafish : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against DDC. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name DDC
Background DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Molecular Weight 53 kDa
Gene ID 1644
NCBI Accession NM_000790, NP_000781
UniProt P20711
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 480 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC) (N-Term) antibody WB Suggested Anti-DDC Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate
anti-Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC) (N-Term) antibody (2) anti-Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC) (N-Term) antibody (Image 2)
Background publications Ma, Beuten, Payne et al.: "Haplotype analysis indicates an association between the DOPA decarboxylase (DDC) gene and nicotine dependence." in: Human molecular genetics, Vol. 14, Issue 12, pp. 1691-8, 2005 (PubMed).

Validation Images
back to top