Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310148

Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AADC, zgc:65801, zgc:76929, wu:fa56d05, wu:fd59h03, wu:fk20h01, Aadc, 5-HT, CG10697, DDC, DdcDm, Dmel\\CG10697, ddc, fDDC, l(2)37Bl, l(2)37Ch, l(2)k02104, AMD-r, CG10501, CG17345, Dmel\\CG10501, X0469 ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310148
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC
Sequence EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPA AAPQEPDTFE
Predicted Reactivity African clawed frog : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Bovine : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%, Zebrafish : 92%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against DDC. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name DDC
Background DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Molecular Weight 53kDa
Gene ID 1644
NCBI Accession NP_000781, NM_000790
UniProt P20711
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DDC antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ma, Beuten, Payne et al.: "Haplotype analysis indicates an association between the DOPA decarboxylase (DDC) gene and nicotine dependence." in: Human molecular genetics, Vol. 14, Issue 12, pp. 1691-8, 2005 (PubMed).

Alternatives for antigen "Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC)", type "Antibodies"
Hosts (56), (8), (7), (7), (2)
Reactivities (62), (34), (27), (21), (12), (10), (10), (9), (3), (2), (1)
Applications (69), (22), (11), (10), (7), (5), (4), (3), (1), (1)
Conjugates (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (6), (6), (2), (1), (1), (1)
Beacon