Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC) antibody
| Antigen | Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC) |
| Synonyms |
AADC, Aadc, MGC93628, CG17345, X04695, fAMD, l(2)37Bk, l(2)amd, l(2)amd alpha-methyldopa hypersensitive, l(2)amd[H], DmelCG10501, CG10501, 5-HT, DDC, DdcDm, fDDC, l(2)37Bl, l(2)37Ch, l(2)k02104, DmelC ...
show more
|
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Rat (Rattus), Xenopus laevis, Zebrafish, Pig (Porcine) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN310148 |
| Quantity | 0.1 mg (Variants) |
| Price | 251.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | AADC / DDC |
| Gene ID | DDC |
| UniProt | P20711 |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC |
| Sequence | EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPA AAPQEPDTFE |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 100 µl of distilled water. Final anti-DDC antibody concentration is 1 mg/ml. |
| Description | DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. |
| Characteristics | Antigen Size: 480 amino acids |
| Molecular Weight | 53kDa |
| Synonyms | AADC, Aadc, MGC93628, CG17345, X04695, fAMD, l(2)37Bk, l(2)amd, l(2)amd alpha-methyldopa hypersensitive, l(2)amd[H], DmelCG10501, CG10501, 5-HT, DDC, DdcDm, fDDC, l(2)37Bl, l(2)37Ch, l(2)k02104, DmelCG10697, CG10697, zgc:65801, zgc:76929, wu:fa56d05, wu:fd59h03, wu:fk20h01, Ddc, DdcDv, dvir_GLEANR_2561, Dvir\GJ17995, GJ17995, ddc |
Application Details
| Application Notes |
WB Suggested Anti-DDC Antibody Titration: 5.0ug/ml Positive Control: HepG2 cell lysate. |
| Purification | Protein A purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-DDC Antibody Titration: 5.0ug/ml Positive Control: HepG2 cell lysate anti-Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC) antibody (Image 2) |
Publications
| Product |
Ma, Beuten, Payne et al.: "Haplotype analysis indicates an association between the DOPA decarboxylase (DDC) gene and nicotine dependence." in: Human molecular genetics, Vol. 14, Issue 12, pp. 1691-8, 2005 (PubMed).
|
Alternatives
Alternatives for antigen "Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC)", type "Antibodies"
| Hosts | Rabbit (47), Goat (5), Sheep (5), Mouse (3) |
| Reactivities | Human (52), Rat (Rattus) (36), Mouse (Murine) (24), Cow (Bovine) (13), Dog (Canine) (9), Guinea Pig (8), Sheep (Ovine) (7), Rabbit (6), Cat (Feline) (1), Chicken (1) |
| Applications | Western Blotting (WB) (43), ELISA (18), Immunofluorescence (IF) (17), Immunohistochemistry (IHC) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Fixed) (IHC (fx)) (1) |
| Conjugates | Biotin (2), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | N-Term (7), C-Term (3), AA 1-480 (1), Internal Region (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
