Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Claudin 18 (CLDN18) antibody

Antigen

Claudin 18 (CLDN18)
Synonyms SFTA5, SFTPJ, DKFZp564B2062, MGC68719, claudin-18, CLDN18, MGC140810
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310149
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Claudin 18 (CLDN18) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name Claudin-18 / CLDN18
Gene ID CLDN18
UniProt P56856
Immunogen The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18
Sequence PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI YDGGARTEDE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CLDN18 antibody concentration is 1 mg/ml.
Description CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells.CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells (Niimi et al., 2001).[supplied by OMIM].
Characteristics Antigen Size: 261 amino acids
Molecular Weight 28kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-CLDN18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Claudin 18 (CLDN18)", type "Antibodies"
Hosts Rabbit (15)
Reactivities Human (11), Mouse (Murine) (6), Rat (Rattus) (5), Cow (Bovine) (2), Dog (Canine) (2), Cat (Feline) (1), Chicken (1), Pig (Porcine) (1)
Applications Western Blotting (WB) (15), ELISA (8), Immunohistochemistry (IHC) (3), Immunofluorescence (IF) (2), Flow Cytometry (FACS) (1), Immunohistochemistry (Fixed) (IHC (fx)) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (3), Internal Region (2), Center (1)