Actinin, alpha 2 (ACTN2) antibody

Antigen: Actinin, alpha 2 (ACTN2)

Synonyms: CMD1AA, CEF1, hCDC5, PCDC5RP, KIAA0432, dJ319D22.1, MGC107582, 1110008F24Rik, ACTN2, actn3, actnl, MGC63559, zgc:63559, MGC79034, MGC89234, MGC128123, MGC123223, wu:fd44c03, zgc:123223

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310156

Additional Information

Alternative name: Alpha-actinin-2 / ACTN2

Gene ID: ACTN2

UniProt: P35609

Immunogen: The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2

Sequence: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYS GPGSVPGALD

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ACTN2 antibody concentration is 1 mg/ml.

Description: The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles. Transcript variants resulting from the use of multiple poly_A sites have been observed.

Characteristics: Antigen Size: 894 amino acids

Molecular Weight: 98kDa

Application Details

Application Notes: WB Suggested Anti-ACTN2 Antibody Titration: 1.25ug/ml
Positive Control: Human heart.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ACTN2 Antibody Titration: 1.25ug/ml
Positive Control: Human heart

anti-Actinin, alpha 2 (ACTN2) antibody (Image 2)

Publications

Product: Eldstrom, Choi, Steele et al.: "SAP97 increases Kv1.5 currents through an indirect N-terminal mechanism." in: FEBS letters, Vol. 547, Issue 1-3, pp. 205-11, 2003 (PubMed).