Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310180

Chromosome 11 Open Reading Frame 54 (C11orf54) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PTD012, C11orf54
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310180
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C11orf54 antibody: synthetic peptide directed towards the N terminal of human C11orf54
Sequence CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKV YDLNKIAKEI
Predicted Reactivity Dog : 100%, Human : 100%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against C11orf54. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C11orf54
Background The exact function of C11orf54 remains unknown.
Molecular Weight 29kDa
Gene ID 28970
NCBI Accession NP_054758, NM_014039
UniProt Q9H0W9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C11orf54 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Manjasetty, Büssow, Fieber-Erdmann et al.: "Crystal structure of Homo sapiens PTD012 reveals a zinc-containing hydrolase fold." in: Protein science : a publication of the Protein Society, Vol. 15, Issue 4, pp. 914-20, 2006 (PubMed).

Alternatives for antigen "Chromosome 11 Open Reading Frame 54 (C11orf54)", type "Antibodies"
Hosts (6)
Reactivities (4), (1), (1), (1), (1), (1), (1)
Applications (6), (3), (1)
Epitopes (3), (1)
Beacon