Chromosome 11 Open Reading Frame 54 (C11orf54) (N-Term) antibody

Details for Product No. ABIN310180
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms PTD012, C11orf54
Epitope
N-Term
(2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(4), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(5), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310180
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C11orf54
Sequence CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKV YDLNKIAKEI
Predicted Reactivity Dog : 100 %, Human : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against C11orf54. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C11orf54
Background The exact function of C11orf54 remains unknown.
Molecular Weight 29 kDa
Gene ID 28970
NCBI Accession NM_014039, NP_054758
UniProt Q9H0W9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 265 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Manjasetty, Büssow, Fieber-Erdmann et al.: "Crystal structure of Homo sapiens PTD012 reveals a zinc-containing hydrolase fold." in: Protein science : a publication of the Protein Society, Vol. 15, Issue 4, pp. 914-20, 2006 (PubMed).

Hosts (5), (1)
Reactivities (4), (1), (1), (1), (1), (1), (1)
Applications (6), (1), (1)
Epitopes (2), (1)
back to top