Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Steroid Sulfatase (Microsomal), Isozyme S (STS) antibody

Antigen

Steroid Sulfatase (Microsomal), Isozyme S (STS)
Synonyms ES, ASC, XLI, ARSC, SSDD, ARSC1, STS, ABCG2, BCRP, abcg2
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Pig (Porcine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN310209
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Steroid Sulfatase (Microsomal), Isozyme S (STS) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name Steryl-sulfatase
Gene ID STS
UniProt P08842
Immunogen The immunogen for anti-STS antibody: synthetic peptide directed towards the C terminal of human STS
Sequence LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQT LPEVPDQFSW
Cross-Reactivity Cow (Bovine), Human, Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-STS antibody concentration is 1 mg/ml.
Description STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).
Characteristics Antigen Size: 583 amino acids
Molecular Weight 64kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-STS Antibody Titration: 5.0ug/ml
Positive Control: Human Placenta.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Steroid Sulfatase (Microsomal), Isozyme S (STS)", type "Antibodies"
Hosts Rabbit (30), Goat (4), Mouse (1)
Reactivities Human (31), Mouse (Murine) (23), Rat (Rattus) (22), Cow (Bovine) (20), Dog (Canine) (20), Pig (Porcine) (20), Horse (Equine) (19)
Applications Western Blotting (WB) (17), Immunofluorescence (IF) (16), ELISA (12), Immunohistochemistry (IHC) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1), Indirect ELISA (iELISA) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), Internal Region (2)