Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310244

Pregnancy Specific beta-1-Glycoprotein 6 (PSG6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PSBG-10, PSBG-12, PSBG-6, PSG10, PSGGB, PSG6, PSG3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310244
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSG6 antibody: synthetic peptide directed towards the N terminal of human PSG6
Sequence VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIY GPAYSGRETV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against PSG6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PSG6
Background PSG6 may have a role in modulation of the innate immune system.
Molecular Weight 47kDa
Gene ID 5675
NCBI Accession NP_001027020, NM_001031850
UniProt Q15235
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSG6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Teglund, Zhou, Hammarström: "Characterization of cDNA encoding novel pregnancy-specific glycoprotein variants." in: Biochemical and biophysical research communications, Vol. 211, Issue 2, pp. 656-64, 1995 (PubMed).

Alternatives for antigen "Pregnancy Specific beta-1-Glycoprotein 6 (PSG6)", type "Antibodies"
Hosts (7), (1)
Reactivities (7)
Applications (8), (1)
Epitopes (4), (3), (1)
Beacon