Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310267

Keratin 8 (KRT8) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CARD2, CK-8, CK8, CYK8, K2C8, K8, KO, AA960620, AL022697, AU019895, Card2, EndoA, Krt-2.8, Krt2-8, CYKER, KRT2-8, KERATIN8, DreK8, cb186, krt2-8, sb:cb186, wu:fa20h05, wu:fa95h10, wu:fb96c06, zf-K8, z ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310267
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KRT8 antibody: synthetic peptide directed towards the N terminal of human KRT8
Sequence MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSR VGSSNFRGGL
Predicted Reactivity Human : 100%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against KRT8. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name KRT8
Background KRT8 together with KRT19, help to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Molecular Weight 53kDa
Gene ID 3856
NCBI Accession NP_002264, NM_002273
UniProt P05787
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KRT8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Keratin 8 (KRT8)", type "Antibodies"
Hosts (204), (168), (4), (3)
Reactivities (348), (103), (72), (28), (22), (17), (13), (13), (12), (10), (7), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1)
Applications (239), (182), (90), (89), (87), (77), (50), (41), (40), (23), (18), (10), (5), (3), (1), (1)
Conjugates (17), (8), (5), (4), (4), (4), (4), (4), (4), (4), (4), (1), (1)
Epitopes (20), (17), (15), (14), (14), (13), (12), (10), (6), (5), (4), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon