PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1) (N-Term) antibody

Details for Product No. ABIN310286
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms liprin-beta-1, L2, SGT2, hSGT2, hSgt2p, 4632409B19Rik, AW214454, AW261454
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Fruit Fly (Drosophila melanogaster), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(8), (3), (3)
Host
Rabbit
(9)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN310286
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PPFIBP1
Sequence PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAE TLVEWLQSQM
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Dog : 90 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against PPFIBP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PPFIBP1
Background PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Molecular Weight 19 kDa
Gene ID 8496
NCBI Accession NM_177444, NP_803193
UniProt Q86W92-5
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 170 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1) (N-Term) antibody WB Suggested Anti-PPFIBP1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
Background publications Kriajevska, Fischer-Larsen, Moertz et al.: "Liprin beta 1, a member of the family of LAR transmembrane tyrosine phosphatase-interacting proteins, is a new target for the metastasis-associated protein S100A4 (Mts1)." in: The Journal of biological chemistry, Vol. 277, Issue 7, pp. 5229-35, 2002 (PubMed).

Hosts (9)
Reactivities (8), (3), (3)
Applications (8), (3), (2)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top