Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 19 (ZNF19) antibody

Antigen

Zinc Finger Protein 19 (ZNF19)

Synonyms KOX12, MGC51021
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN310322
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF19
Gene ID ZNF19
UniProt P17023
Immunogen The immunogen for anti-ZNF19 antibody: synthetic peptide directed towards the N terminal of human ZNF19
Sequence TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVC KDVETNIDSE
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF19 antibody concentration is 1 mg/ml.
Description ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.
Characteristics Antigen Size: 458 amino acids
Molecular Weight 52kDa

Application Details

Application Notes WB Suggested Anti-ZNF19 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 19 (ZNF19)", type "Antibodies"
Hosts Rabbit (6), Mouse (3)
Reactivities Human (7)
Applications Western Blotting (WB) (6), Dot Blot (DB) (1), Dot Blot (Dot) (1)
Epitopes C-Term (1), N-Term (1)