Zinc Finger Protein 19 (ZNF19) antibody

Antigen: Zinc Finger Protein 19 (ZNF19)

Synonyms: KOX12, MGC51021

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN310322

Additional Information

Alternative name: ZNF19

Gene ID: ZNF19

UniProt: P17023

Immunogen: The immunogen for anti-ZNF19 antibody: synthetic peptide directed towards the N terminal of human ZNF19

Sequence: TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVC KDVETNIDSE

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF19 antibody concentration is 1 mg/ml.

Description: ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.

Characteristics: Antigen Size: 458 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-ZNF19 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF19 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).