ZNF19 antibody (C-Term)

Catalog No. ABIN629628

Product Details anti-ZNF19 Antibody

Target: ZNF19 (Zinc Finger Protein 19 (ZNF19))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF19 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZNF19 antibody was raised against the C terminal of ZNF19

Purification: Purified

Immunogen: ZNF19 antibody was raised using the C terminal of ZNF19 corresponding to a region with amino acids HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZNF19 Blocking Peptide, catalog no. 33R-3824, is also available for use as a blocking control in assays to test for specificity of this ZNF19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZNF19

Target: ZNF19 (Zinc Finger Protein 19 (ZNF19))

Alternative Name: ZNF19 (ZNF19 Products)

Synonyms: KOX12 antibody, zinc finger protein 19 antibody, ZNF19 antibody

Background: ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.

Molecular Weight: 52 kDa (MW of target protein)