Did you know that you can buy products from over 140 different suppliers from us?

BPI Fold Containing Family A, Member 1 (BPIFA1) (Middle Region) antibody

Details for Product No. ABIN310347
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LUNX, NASG, Plunc, SPLUNC1, SPURT, PLUNC, bA49G10.5
Epitope
Middle Region
(3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Human
(9)
Host
Rabbit
(5), (4), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (8), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310347
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PLUNC
Sequence GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQ VNTPLVGASL
Predicted Reactivity Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against PLUNC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PLUNC
Background PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this gene is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only two is known.
Molecular Weight 28 kDa
Gene ID 51297
NCBI Accession NM_016583, NP_057667
UniProt Q9NP55
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 256 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-BPI Fold Containing Family A, Member 1 (BPIFA1) (Middle Region) antibody WB Suggested Anti-PLUNC Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
anti-BPI Fold Containing Family A, Member 1 (BPIFA1) (Middle Region) antibody (2) anti-BPI Fold Containing Family A, Member 1 (BPIFA1) (Middle Region) antibody (Image 2)
Background publications Zhou, Li, Yang et al.: "Intracellular co-localization of SPLUNC1 protein with nanobacteria in nasopharyngeal carcinoma epithelia HNE1 cells depended on the bactericidal permeability increasing protein domain." in: Molecular immunology, Vol. 43, Issue 11, pp. 1864-71, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310347
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top