Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. Cerevisiae) (DCUN1D1) antibody

Antigen

DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. Cerevisiae) (DCUN1D1)

Synonyms RP42, SCRO, Tes3, SCCRO, DCUN1L1, fd19a01, zgc:66414, wu:fd19a01, Rp42, pTes3, C85469, DCUN1D1, MGC165752
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN310365
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name DCUN1D1
Gene ID DCUN1D1
UniProt Q96GG9
Immunogen The immunogen for anti-DCUN1D1 antibody: synthetic peptide directed towards the N terminal of human DCUN1D1
Sequence SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN RYKDPQDENK
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-DCUN1D1 antibody concentration is 1 mg/ml.
Description DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Characteristics Antigen Size: 259 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-DCUN1D1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer, Proteolysis / Ubiquitin
Restrictions For Research Use only

Publications

Product Kurz, Ozlü, Rudolf et al.: "The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae." in: Nature, Vol. 435, Issue 7046, pp. 1257-61, 2005 (PubMed).

Alternatives

Alternatives for antigen "DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. Cerevisiae) (DCUN1D1)", type "Antibodies"
Hosts Rabbit (44), Goat (3), Mouse (3)
Reactivities Human (48), Mouse (Murine) (39), Cow (Bovine) (38), Rat (Rattus) (38), Chicken (37), Dog (Canine) (37), Horse (Equine) (36), Pig (Porcine) (18), Cat (Feline) (1)
Applications Immunofluorescence (IF) (32), Western Blotting (WB) (19), ELISA (15), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (IHC) (5), Immunoelectron Microscopy (IEM) (2), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Biotin (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2)
Epitopes C-Term (1), Internal Region (1), N-Term (1)