Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310404

Protein Kinase C, zeta (PRKCZ) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
PKC2, PKC-ZETA, Pkcz, C80388, R74924, zetaPKC, AI098070, aPKCzeta, r14-3-3, 14-3-3-zetaisoform, pkcz, si:ch211-150o23.4, PKCzeta, TPKC, prkcz-A, pkc-zeta, PKC-B, Prkcb, prkcb1, zgc:63591, PRKCB1, PRKC ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310404
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRKCZ antibody: synthetic peptide directed towards the N terminal of human PRKCZ
Sequence MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDS IKDDSEDLKP
Predicted Reactivity Human : 100%, Mouse : 91%, Rat : 91%, Bovine : 76%, Dog : 75%, Guinea pig : 75%, Horse : 75%
Characteristics This is a rabbit polyclonal antibody against PRKCZ. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRKCZ
Background Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC.Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight 45kDa
Gene ID 5590
NCBI Accession NP_001028753, NM_001033581
UniProt Q05513
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRKCZ antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Xie, Dong, Zhang et al.: "Activation of protein kinase C zeta by peroxynitrite regulates LKB1-dependent AMP-activated protein kinase in cultured endothelial cells." in: The Journal of biological chemistry, Vol. 281, Issue 10, pp. 6366-75, 2006 (PubMed).

Alternatives for antigen "Protein Kinase C, zeta (PRKCZ)", type "Antibodies"
Hosts (136), (3)
Reactivities (124), (88), (84), (24), (12), (12), (12), (1), (1)
Applications (83), (58), (43), (36), (30), (30), (9), (9), (8), (2), (2), (1), (1), (1), (1), (1)
Conjugates (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Epitopes (31), (12), (12), (8), (5), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon