Protein Kinase C, zeta (PRKCZ) antibody

Antigen: Protein Kinase C, zeta (PRKCZ)

Synonyms: PKC2, PKC-ZETA, PKCB, PRKCB1, PRKCB2, MGC41878, PKC-beta, Pkcb, Prkcb1, Prkcb2, PKC-Beta, A130082F03Rik, Pkcz, C80388, R74924, zetaPKC, AI098070, aPKCzeta, r14-3-3, 14-3-3-zetaisoform, TPKC, PKCzeta, prkcz-A, pkc-zeta, Prkcb, MGC63591, zgc:63591, PRKCB, PRKCZ, pkcz, si:ch211-150o23.4, pkc2, DKFZp459N0420

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310404

Additional Information

Alternative name: PRKCZ

Gene ID: PRKCZ

Immunogen: The immunogen for anti-PRKCZ antibody: synthetic peptide directed towards the N terminal of human PRKCZ

Sequence: MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDS IKDDSEDLKP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PRKCZ antibody concentration is 1 mg/ml.

Description: Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC.Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms.

Characteristics: Antigen Size: 409 amino acids

Molecular Weight: 45kDa

Synonyms: PKC2, PKC-ZETA, PKCB, PRKCB1, PRKCB2, MGC41878, PKC-beta, Pkcb, Prkcb1, Prkcb2, PKC-Beta, A130082F03Rik, Pkcz, C80388, R74924, zetaPKC, AI098070, aPKCzeta, r14-3-3, 14-3-3-zetaisoform, TPKC, PKCzeta, prkcz-A, pkc-zeta, Prkcb, MGC63591, zgc:63591, PRKCB, PRKCZ, pkcz, si:ch211-150o23.4, pkc2, DKFZp459N0420

Application Details

Application Notes: WB Suggested Anti-PRKCZ Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PRKCZ Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Xie, Dong, Zhang et al.: "Activation of protein kinase C zeta by peroxynitrite regulates LKB1-dependent AMP-activated protein kinase in cultured endothelial cells." in: The Journal of biological chemistry, Vol. 281, Issue 10, pp. 6366-75, 2006 (PubMed).