Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3) antibody

Antigen

Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3)

Synonyms E2-F1, L-UBC, UBCH7, UbcM4, Ubce7, C79827, MGC118100, zgc:86727, wu:fc22h11, MGC114833, MGC132024, UBE2L3, MGC127956, DKFZp469G1720
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis, Pig (Porcine), Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310414
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name UBE2L3 / UBCH7
Gene ID UBE2L3
UniProt P68036
Immunogen The immunogen for anti-UBE2L3 antibody: synthetic peptide directed towards the C terminal of human UBE2L3
Sequence IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFT KKYGEKRPVD
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-UBE2L3 antibody concentration is 1 mg/ml.
Description UBE2L3(ubiquitin-conjugating enzyme E2L 3) Antibody The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Characteristics Antigen Size: 154 amino acids
Molecular Weight 17kDa

Application Details

Application Notes WB Suggested Anti-UBE2L3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives

Alternatives for antigen "Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3)", type "Antibodies"
Hosts Rabbit (39), Goat (6), Mouse (1)
Reactivities Human (41), Mouse (Murine) (26), Rat (Rattus) (25), Cow (Bovine) (22), Dog (Canine) (20), Pig (Porcine) (20), Zebrafish (Danio rerio) (18), Chicken (2), Xenopus laevis (2), Zebrafish (2), Fruit Fly (Drosophila melanogaster) (1)
Applications Western Blotting (WB) (29), ELISA (19), Immunofluorescence (IF) (17), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (8), Immunohistochemistry (IHC) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (6), N-Term (2), Internal Region (1)