Cell Division Cycle 23 Homolog (S. Cerevisiae) (CDC23) antibody

Antigen: Cell Division Cycle 23 Homolog (S. Cerevisiae) (CDC23)

Synonyms: APC8, CDC23, MGC151719

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine), Rat (Rattus), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310418

Additional Information

Alternative name: CDC23 / APC8

Gene ID: CDC23

UniProt: Q9UJX2

Immunogen: The immunogen for anti-CDC23 antibody: synthetic peptide directed towards the C terminal of human CDC23

Sequence: DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSAN NTPTRRVSPL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CDC23 antibody concentration is 1 mg/ml.

Description: CDC23 shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eukaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.

Characteristics: Antigen Size: 591 amino acids

Molecular Weight: 65kDa

Application Details

Application Notes: WB Suggested Anti-CDC23 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Coagulation

Restrictions: For Research Use only

Images

WB Suggested Anti-CDC23 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).