Zinc Finger, DHHC-Type Containing 13 (ZDHHC13) antibody

Antigen: Zinc Finger, DHHC-Type Containing 13 (ZDHHC13)

Synonyms: HIP14L, HIP3RP, FLJ10852, FLJ10941, MGC64994, MGC156470, ZDHHC13, wu:fb06e01, wu:fc39g10, zgc:101690, DKFZp459C2410

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310595

Additional Information

Alternative name: ZDHHC13

Gene ID: ZDHHC13

UniProt: Q8IUH4-3

Immunogen: The immunogen for anti-ZDHHC13 antibody: synthetic peptide directed towards the N terminal of human ZDHHC13

Sequence: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLIS KGQSVNMTDV

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZDHHC13 antibody concentration is 1 mg/ml.

Description: ZDHHC13 may be involved in the NF-kappa-B signaling pathway.

Characteristics: Antigen Size: 492 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-ZDHHC13 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-ZDHHC13 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

anti-Zinc Finger, DHHC-Type Containing 13 (ZDHHC13) antibody (Image 2)

Publications

Product: Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).