ZDHHC13 antibody (N-Term)
-
- Target See all ZDHHC13 Antibodies
- ZDHHC13 (Zinc Finger, DHHC-Type Containing 13 (ZDHHC13))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZDHHC13 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ZDHHC13 antibody was raised against the N terminal of ZDHHC13
- Purification
- Purified
- Immunogen
- ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
- Top Product
- Discover our top product ZDHHC13 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZDHHC13 Blocking Peptide, catalog no. 33R-6586, is also available for use as a blocking control in assays to test for specificity of this ZDHHC13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC13 (Zinc Finger, DHHC-Type Containing 13 (ZDHHC13))
- Alternative Name
- ZDHHC13 (ZDHHC13 Products)
- Synonyms
- ZDHHC13 antibody, 2410004E01Rik antibody, C530010M18 antibody, HIP3RP antibody, Hip14l antibody, kojak antibody, skc4 antibody, wu:fb06e01 antibody, wu:fc39g10 antibody, wu:fi22e09 antibody, zgc:101690 antibody, HIP14L antibody, zinc finger DHHC-type containing 13 antibody, zinc finger, DHHC domain containing 13 antibody, zinc finger, DHHC-type containing 13 antibody, ZDHHC13 antibody, Zdhhc13 antibody, zdhhc13 antibody
- Background
- ZDHHC13 may be involved in the NF-kappa-B signaling pathway.
- Molecular Weight
- 54 kDa (MW of target protein)
-