Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310643

MGC39633 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310643
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MGC39633 antibody: synthetic peptide directed towards the N terminal of human MGC39633
Sequence VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELE NKLIHSRKTE
Predicted Reactivity Human :100%,   Crab-eating macaque :100%,   Mouse :85%,   Rat :78%,  
Characteristics This is a rabbit polyclonal antibody against MGC39633. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Background The function remains unknown.
Molecular Weight 62kDa
Gene ID 153733
NCBI Accession NP_001035530, NM_001040440
UniProt Q6A334
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MGC39633 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives for antigen "MGC39633", type "Antibodies"
Hosts (1)
Applications (1), (1)
Beacon