Did you know that you can buy products from over 140 different suppliers from us?

MGC39633 (N-Term) antibody

Details for Product No. ABIN310643
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Human
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310643
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MGC39633
Sequence VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELE NKLIHSRKTE
Predicted Reactivity Human :100 %,   Crab-eating macaque :100 %,   Mouse :80 %,   Rat :70 %,  
Characteristics This is a rabbit polyclonal antibody against MGC39633. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Background The function remains unknown.
Molecular Weight 62 kDa
Gene ID 153733
NCBI Accession NM_001040440, NP_001035530
UniProt Q6A334
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 529 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MGC39633 (N-Term) antibody WB Suggested Anti-MGC39633 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-MGC39633 (N-Term) antibody (2) anti-MGC39633 (N-Term) antibody (Image 2)
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Hosts (1)
Applications (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310643
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top