MGC39633 (N-Term) antibody

Details for Product No. ABIN310643
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Human
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(1), (1)
Pubmed 1 reference available
Catalog no. ABIN310643
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MGC39633
Sequence VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELE NKLIHSRKTE
Predicted Reactivity Human :100 %,   Crab-eating macaque :100 %,   Mouse :80 %,   Rat :70 %,  
Characteristics This is a rabbit polyclonal antibody against MGC39633. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Background The function remains unknown.
Molecular Weight 62 kDa
Gene ID 153733
NCBI Accession NM_001040440, NP_001035530
UniProt Q6A334
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 529 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MGC39633 (N-Term) antibody WB Suggested Anti-MGC39633 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-MGC39633 (N-Term) antibody (2) anti-MGC39633 (N-Term) antibody (Image 2)
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Hosts (1)
Applications (1), (1)
back to top