NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5) (Middle Region) antibody

Details for Product No. ABIN310669
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CISGDH, SGDH, AU015782, 0610007D05Rik, hm:zeh0024, zgc:123331
Epitope
Middle Region
(2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Fruit Fly (Drosophila melanogaster), Human, Chicken
(7), (1)
Host
Rabbit
(5), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310669
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NDUFB5
Sequence KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPE HWEYYKHPIS
Predicted Reactivity Human : 100 %, African clawed frog : 90 %, Bovine : 90 %, Chicken : 80 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against NDUFB5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NDUFB5
Background NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Molecular Weight 17 kDa
Gene ID 4711
NCBI Accession NM_002492, NP_002483
UniProt O43674
Research Area Cancer, Metabolism, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 189 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5) (Middle Region) antibody WB Suggested Anti-NDUFB5 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Ton, Hwang, Dempsey et al.: "Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits." in: Biochemical and biophysical research communications, Vol. 241, Issue 2, pp. 589-94, 1998 (PubMed).

Hosts (5), (4)
Reactivities (7), (1)
Applications (9), (3), (2), (1), (1), (1)
Epitopes (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top