Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310669

NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CISGDH, SGDH, AU015782, 0610007D05Rik, hm:zeh0024, zgc:123331
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310669
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NDUFB5 antibody: synthetic peptide directed towards the middle region of human NDUFB5
Sequence KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPE HWEYYKHPIS
Predicted Reactivity Human : 100%, African clawed frog : 92%, Bovine : 92%, Chicken : 85%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against NDUFB5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NDUFB5
Background NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Molecular Weight 17kDa
Gene ID 4711
NCBI Accession NP_002483, NM_002492
UniProt O43674
Research Area Cancer, Metabolism, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NDUFB5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ton, Hwang, Dempsey et al.: "Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits." in: Biochemical and biophysical research communications, Vol. 241, Issue 2, pp. 589-94, 1998 (PubMed).

Alternatives for antigen "NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5)", type "Antibodies"
Hosts (5), (4)
Reactivities (7), (1)
Applications (9), (5), (2), (1)
Epitopes (3), (1), (1), (1)
Beacon