Did you know that you can buy products from over 140 different suppliers from us?

Pseudouridylate Synthase 7 Homolog (S. Cerevisiae) (PUS7) (N-Term) antibody

Details for Product No. ABIN310801
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C330017I15Rik, RGD1307054
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human
(8), (4), (3), (2)
Host
Rabbit
(7), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (5), (3)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310801
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PUS7
Sequence FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVH EIGKDGRISH
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, African clawed frog : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PUS7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PUS7
Background The function remains unknown.
Molecular Weight 75 kDa
Gene ID 54517
NCBI Accession NM_019042, NP_061915
UniProt Q96PZ0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 661 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Hillier, Fulton, Fulton et al.: "The DNA sequence of human chromosome 7." in: Nature, Vol. 424, Issue 6945, pp. 157-64, 2003 (PubMed).

Hosts (7), (2)
Reactivities (8), (4), (3), (2)
Applications (9), (5), (3)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310801
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top