Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310801

Pseudouridylate Synthase 7 Homolog (S. Cerevisiae) (PUS7) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C330017I15Rik, RGD1307054
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310801
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PUS7 antibody: synthetic peptide directed towards the N terminal of human PUS7
Sequence FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVH EIGKDGRISH
Predicted Reactivity Bovine : 100%, Chicken : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, African clawed frog : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against PUS7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PUS7
Background The function remains unknown.
Molecular Weight 75kDa
Gene ID 54517
NCBI Accession NP_061915, NM_019042
UniProt Q96PZ0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PUS7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Fulton, Fulton et al.: "The DNA sequence of human chromosome 7." in: Nature, Vol. 424, Issue 6945, pp. 157-64, 2003 (PubMed).

Alternatives for antigen "Pseudouridylate Synthase 7 Homolog (S. Cerevisiae) (PUS7)", type "Antibodies"
Hosts (7), (2)
Reactivities (8), (4), (3), (2)
Applications (9), (5), (3), (1)
Epitopes (1)
Beacon