Mitochondrial Ribosomal Protein S12 (MRPS12) (N-Term) antibody

Details for Product No. ABIN310803
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RPS12, RPMS12, RPSM12, MPR-S12, MT-RPS12, rps12, Rpms12, AI327385, CG7925, Dmel\\CG7925, EG:BACH59J11.1, MRP-S12, MRPS12, S12, Tko, l(1)3Ab, l(1)tko, mRpS12, mt-rps12, MGC64304, GB10531
Epitope
N-Term
(8), (2), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(18), (12), (2)
Host
Rabbit
(18), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (13), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN310803
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MRPS12
Sequence LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLK GVVLCTFTRK
Predicted Reactivity Dog : 90 %, Rat : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against MRPS12. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MRPS12
Background Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75 % protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene, all three variants encode the same protein.
Molecular Weight 12 kDa
Gene ID 6183
NCBI Accession NM_021107, NP_066930
UniProt O15235
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 138 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitochondrial Ribosomal Protein S12 (MRPS12) (N-Term) antibody WB Suggested Anti-MRPS12 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Zhang, Gerstein: "Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome." in: Genomics, Vol. 81, Issue 5, pp. 468-80, 2003 (PubMed).

Hosts (18), (1)
Reactivities (18), (12), (2)
Applications (18), (13), (2), (2), (1), (1)
Epitopes (8), (2), (1), (1), (1), (1)
back to top