Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310861

Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C15orf22, P24B, p26, 1200002G13Rik, AW546672, P24b, TMED3, wu:fb09b11
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN310861
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMED3 antibody: synthetic peptide directed towards the C terminal of human TMED3
Sequence DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTE KRPISRAVHS
Predicted Reactivity Human : 100%, Bovine : 92%, Rat : 92%, Guinea pig : 85%, Mouse : 85%, Dog : 78%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against TMED3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name TMED3
Background The function remains known.
Molecular Weight 25kDa
Gene ID 23423
NCBI Accession NP_031390, NM_007364
UniProt Q9Y3Q3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMED3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Alternatives for antigen "Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3)", type "Antibodies"
Hosts (7)
Reactivities (6), (2), (2)
Applications (7), (3)
Epitopes (4), (2), (1)
Beacon