Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3) (C-Term) antibody

Details for Product No. ABIN310861
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C15orf22, P24B, p26, 1200002G13Rik, AW546672, P24b, TMED3, wu:fb09b11
Epitope
C-Term
(1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
(5), (3), (3)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2)
Pubmed 2 references available
Catalog no. ABIN310861
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TMED3
Sequence DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTE KRPISRAVHS
Predicted Reactivity Human : 100 %, Bovine : 90 %, Rat : 90 %, Guinea pig : 80 %, Mouse : 80 %, Dog : 70 %, Rabbit : 70 %
Characteristics This is a rabbit polyclonal antibody against TMED3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TMED3
Background The function remains known.
Molecular Weight 25 kDa
Gene ID 23423
NCBI Accession NM_007364, NP_031390
UniProt Q9Y3Q3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 217 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3) (C-Term) antibody WB Suggested Anti-TMED3 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

General Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Hosts (6)
Reactivities (5), (3), (3)
Applications (6), (2)
Epitopes (1), (1)
back to top