Tetraspanin 12 (TSPAN12) antibody

Antigen: Tetraspanin 12 (TSPAN12)

Synonyms: NET2, NET-2, TM4SF12, MGC137611, DKFZp469F0634

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310867

Additional Information

Alternative name: Tetraspanin-12 (TSPAN12)

Gene ID: TSPAN12

UniProt: O95859

Immunogen: The immunogen for anti-TSPAN12 antibody: synthetic peptide directed towards the middle region of human TSPAN12

Sequence: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLR FLGISIGVTQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TSPAN12 antibody concentration is 1 mg/ml.

Description: TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Characteristics: Antigen Size: 305 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-TSPAN12 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TSPAN12 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).