Zinc Finger Protein 131 (ZNF131) (N-Term) antibody

Details for Product No. ABIN310921
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZBTB35, pHZ-10, 2610109I01Rik, AW558871, Znf131, zgc:66182, zgc:77600
Epitope
N-Term
(4), (3), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(54), (28), (26), (14), (14), (1)
Host
Rabbit
(42), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(31), (20), (14), (6), (4), (3), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN310921
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF131
Sequence MEAEETMECLQEFPEHHKMILDRLNEQREQDRFTDITLIV DGHHFKAHKA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Chicken : 90 %, African clawed frog : 80 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against ZNF131. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF131
Background ZNF131 may be involved in transcriptional regulation. It plays a role during development and organogenesis as well as in the function of the adult central nervous system.
Molecular Weight 67 kDa
Gene ID 7690
NCBI Accession NM_003432, NP_003423
UniProt P52739-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 589 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 131 (ZNF131) (N-Term) antibody WB Suggested Anti-ZNF131 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Tommerup, Vissing: "Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders." in: Genomics, Vol. 27, Issue 2, pp. 259-64, 1995 (PubMed).

Hosts (42), (11)
Reactivities (54), (28), (26), (14), (14), (1)
Applications (31), (20), (14), (6), (4), (3), (3), (3), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (4), (3), (3), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top