Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310922

ZNF36 (ZKSCAN1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9130423L19Rik, KOX18, PHZ-37, ZNF139, ZNF36, ZSCAN33, 5930429A01Rik, 9230118B16Rik, AI646829, AI788588, C87323
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310922
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZKSCAN1 antibody: synthetic peptide directed towards the N terminal of human ZKSCAN1
Sequence NTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVT LLEDLELDLS
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against ZKSCAN1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZKSCAN1
Background ZKSCAN1 may be involved in transcriptional regulation.
Molecular Weight 63kDa
Gene ID 7586
NCBI Accession NP_003430, NM_003439
UniProt P17029
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZKSCAN1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "ZNF36 (ZKSCAN1)", type "Antibodies"
Hosts (16), (4)
Reactivities (19), (3), (1), (1)
Applications (19), (4), (2), (2), (1), (1), (1)
Epitopes (4), (2), (2), (2), (1), (1), (1), (1)
Beacon