CD36 Molecule (thrombospondin Receptor) (CD36) antibody

Antigen: CD36 Molecule (thrombospondin Receptor) (CD36)

Synonyms: FAT, GP4, GP3B, GPIV, CHDS7, PASIV, SCARB3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Dog (Canine), Pig (Porcine), Rabbit

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310976

Additional Information

Alternative name: CD36

Gene ID: CD36

UniProt: P16671

Immunogen: The immunogen for anti-CD36 antibody: synthetic peptide directed towards the N terminal of human CD36

Sequence: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKK QVVLEEGTIA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Pig (Porcine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CD36 antibody concentration is 1 mg/ml.

Description: CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Three alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.

Characteristics: Antigen Size: 472 amino acids

Molecular Weight: 53kDa

Application Details

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer, Atherosclerosis, Hematopoietic Progenitors, Hematopoietic Stem Cells, CD Antigens, Surface Receptors of Immune Cells

Restrictions: For Research Use only

Images

anti-CD36 Molecule (thrombospondin Receptor) (CD36) antibody

anti-CD36 Molecule (thrombospondin Receptor) (CD36) antibody (Image 2)

Publications

Product: Ozer, Negis, Aytan et al.: "Vitamin E inhibits CD36 scavenger receptor expression in hypercholesterolemic rabbits." in: Atherosclerosis, Vol. 184, Issue 1, pp. 15-20, 2005 (PubMed).