Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311084

UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Galnt9, AU018154, GalNAc-T9, ppGaNTase, GalNAc-T10, C330012K04Rik, wu:fb37e08, zgc:153114, GALNACT10, PPGALNACT10, PPGANTASE10
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311084
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GALNT10 antibody: synthetic peptide directed towards the N terminal of human GALNT10
Sequence VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGD VAVQKKLRSS
Predicted Reactivity Chicken : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against GALNT10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GALNT10
Background GALNT10 belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates.This gene belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) gene family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates. Two transcript variants encoding distinct isoforms have been identified for this gene.
Molecular Weight 31kDa
Gene ID 55568
NCBI Accession NP_060010, NM_017540
UniProt Q86SR1
Research Area Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GALNT10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cheng, Tachibana, Zhang et al.: "Characterization of a novel human UDP-GalNAc transferase, pp-GalNAc-T10." in: FEBS letters, Vol. 531, Issue 2, pp. 115-21, 2002 (PubMed).

Alternatives for antigen "UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10)", type "Antibodies"
Hosts (34), (1)
Reactivities (34), (28), (28), (12), (12), (12)
Applications (25), (23), (12), (11), (10), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (21), (9), (1)
Beacon