Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311086

tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110005N20Rik, 1600025P05Rik, AI314320, Trmt1, MTO2, MTU1, TRMT, TRMT1, TRNT1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311086
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRMU antibody: synthetic peptide directed towards the C terminal of human TRMU
Sequence ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAG MATESPSDSP
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Dog : 92%, Horse : 92%
Characteristics This is a rabbit polyclonal antibody against TRMU. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRMU
Background TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.
Molecular Weight 48kDa
Gene ID 55687
NCBI Accession NP_060476, NM_018006
UniProt O75648
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRMU antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Guan, Yan, Li et al.: "Mutation in TRMU related to transfer RNA modification modulates the phenotypic expression of the deafness-associated mitochondrial 12S ribosomal RNA mutations." in: American journal of human genetics, Vol. 79, Issue 2, pp. 291-302, 2006 (PubMed).

Alternatives for antigen "tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU)", type "Antibodies"
Hosts (7), (4)
Reactivities (10), (1), (1), (1), (1), (1), (1)
Applications (10), (1), (1), (1), (1)
Epitopes (3), (1), (1), (1), (1), (1)
Beacon