tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU) (C-Term) antibody

Details for Product No. ABIN311086
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110005N20Rik, 1600025P05Rik, AI314320, Trmt1, MTO2, MTU1, TRMT, TRMT1, TRNT1
Epitope
C-Term
(1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(9)
Host
Rabbit
(5), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN311086
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TRMU
Sequence ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAG MATESPSDSP
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Dog : 90 %, Horse : 90 %
Characteristics This is a rabbit polyclonal antibody against TRMU. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRMU
Background TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.This gene is a member of the trmU family. It encodes a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.
Molecular Weight 48 kDa
Gene ID 55687
NCBI Accession NM_018006, NP_060476
UniProt O75648
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 421 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU) (C-Term) antibody WB Suggested Anti-TRMU Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Guan, Yan, Li et al.: "Mutation in TRMU related to transfer RNA modification modulates the phenotypic expression of the deafness-associated mitochondrial 12S ribosomal RNA mutations." in: American journal of human genetics, Vol. 79, Issue 2, pp. 291-302, 2006 (PubMed).

Hosts (5), (5)
Reactivities (9)
Applications (9), (2), (1), (1)
Epitopes (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top