Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B) antibody

Antigen: Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B)

Synonyms: C128, RPC2, FLJ10388, DKFZp686B10117

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN311087

Additional Information

Alternative name: POLR3B / RPC2

Gene ID: POLR3B

UniProt: Q9NW08

Immunogen: The immunogen for anti-POLR3B antibody: synthetic peptide directed towards the C terminal of human POLR3B

Sequence: IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKG VCGLIVPQED

Cross-Reactivity: Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-POLR3B antibody concentration is 1 mg/ml.

Description: POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.

Characteristics: Antigen Size: 1133 amino acids

Molecular Weight: 128kDa

Application Details

Application Notes: WB Suggested Anti-POLR3B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-POLR3B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

Publications

Product: Yee, Gong, Huang et al.: "Mutation of RNA Pol III subunit rpc2/polr3b Leads to Deficiency of Subunit Rpc11 and disrupts zebrafish digestive development." in: PLoS biology, Vol. 5, Issue 11, pp. e312, 2007 (PubMed).