Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

PDZ Binding Kinase (PBK) antibody

Antigen

PDZ Binding Kinase (PBK)

Synonyms SPK, CT84, TOPK, Nori-3, FLJ14385, AW538537, D14Ertd732e, 2810434B10Rik, topk, zgc:92050, PBK, MGC165897
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Pig (Porcine), Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311092
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PBK / TOPK
Gene ID PBK
UniProt Q96KB5
Immunogen The immunogen for anti-PBK antibody: synthetic peptide directed towards the N terminal of human PBK
Sequence SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALN MARGLKYLHQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PBK antibody concentration is 1 mg/ml.
Description PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. This genes encodes a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 322 amino acids
Molecular Weight 36kDa

Application Details

Application Notes WB Suggested Anti-PBK Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives

Alternatives for antigen "PDZ Binding Kinase (PBK)", type "Antibodies"
Hosts Rabbit (60), Mouse (12)
Reactivities Human (71), Mouse (Murine) (28), Rat (Rattus) (27), Cow (Bovine) (19), Dog (Canine) (19), Pig (Porcine) (18), Cat (Feline) (1), Chicken (1)
Applications ELISA (46), Western Blotting (WB) (43), Immunofluorescence (IF) (35), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (22), Immunohistochemistry (IHC) (12), Flow Cytometry (FACS) (4), Immunocytochemistry (ICC) (4), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (Dot) (2), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), PE,Cy5.5 (2), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1)
Epitopes pThr9 (8), C-Term (5), N-Term (4), Tyr74 (2), pTyr74 (2), C-Term,Cys300 (1), Met11 (1), Met12 (1), N-Term,Asn6 (1), pThr163 (1)