Did you know that you can buy products from over 140 different suppliers from us?

Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1) (Middle Region) antibody

Details for Product No. ABIN311117
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fd15e12, wu:fd15e12, wu:fi15f10, zgc:123165, 8430411F12Rik, A030012M09Rik, RGD1307986
Epitope
Middle Region
(7), (6), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(12)
Host
Rabbit
(11), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (8), (2)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311117
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PCMTD1
Sequence TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAV RNLQDLARIY
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against PCMTD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PCMTD1
Background The function remains unknown.
Molecular Weight 41 kDa
Gene ID 115294
NCBI Accession NM_052937, NP_443169
UniProt Q96MG8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 357 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1) (Middle Region) antibody WB Suggested Anti-PCMTD1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Validation Images
back to top