Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1) antibody

Antigen: Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1)

Synonyms: HMT1, HMAT1, HMT-1, MGC18946, zgc:66221, wu:fi34b12

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN311183

Additional Information

Alternative name: ALG1 / HMT1

Gene ID: ALG1

UniProt: Q9BT22

Immunogen: The immunogen for anti-ALG1 antibody: synthetic peptide directed towards the N terminal of human ALG1

Sequence: VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDEL LQNNRIQIVG

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ALG1 antibody concentration is 1 mg/ml.

Description: ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).The biosynthesis of lipid-linked oligosaccharides is highly conserved among eukaryotes and is catalyzed by 14 glycosyltransferases in an ordered stepwise manner. Mannosyltransferase I (MT I) catalyzes the first mannosylation step in this process.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-421 BM767933.1 1-421 422-1179 AY359073.1 416-1173 1180-1444 CA455103.1 259-523 1445-1939 CD366777.1 17-511 c 1940-2122 BC031095.1 1931-2113 2123-2149 BQ002699.1 1-27 c

Characteristics: Antigen Size: 464 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-ALG1 Antibody Titration: 0.2-1 ug/ml
Positive Control: NTERA2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ALG1 Antibody Titration: 0.2-1 ug/ml
Positive Control: NTERA2 cell lysate

Publications

Product: Grubenmann, Frank, Hülsmeier et al.: "Deficiency of the first mannosylation step in the N-glycosylation pathway causes congenital disorder of glycosylation type Ik." in: Human molecular genetics, Vol. 13, Issue 5, pp. 535-42, 2004 (PubMed).