Signal Recognition Particle Receptor, B Subunit (SRPRB) (Middle Region) antibody

Details for Product No. ABIN311209
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms APMCF1, AA409543, Cc1-8, Ab2-417, Ba1-667, wu:fk57h10, zgc:111820, zgc:92746, apmcf1
Epitope
Middle Region
(3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
(13), (6), (3), (3), (2)
Host
Rabbit
(9), (5), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(19), (3), (3), (2), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN311209
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SRPRB
Sequence QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTA PAQLGKKGKE
Predicted Reactivity African clawed frog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against SRPRB. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SRPRB
Background SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
Molecular Weight 30 kDa
Gene ID 58477
NCBI Accession NM_021203, NP_067026
UniProt Q9Y5M8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 271 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Signal Recognition Particle Receptor, B Subunit (SRPRB) (Middle Region) antibody WB Suggested Anti-SRPRB Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (9), (5), (5)
Reactivities (13), (6), (3), (3), (2)
Applications (19), (3), (3), (2), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1)
back to top