Zinc Finger, MYND-Type Containing 17 (ZMYND17) (C-Term) antibody

Details for Product No. ABIN311297
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 4833444M15Rik, Zmynd17, ZMYND17
Epitope
C-Term
(4), (2), (2)
Reactivity
Dog (Canine), Cow (Bovine), Human
(6)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (3), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN311297
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZMYND17
Sequence SAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLM EAWLPTLLLL
Predicted Reactivity Dog : 85 %, Bovine : 75 %, Horse : 75 %, Pig : 75 %, Rabbit : 75 %
Characteristics This is a rabbit polyclonal antibody against ZMYND17. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZMYND17
Background ZMYND17 contains 1 MYND-type zinc finger. The exact function of ZMYND17 remains unknown.
Molecular Weight 51 kDa
Gene ID 118490
NCBI Accession NM_001024593, NP_001019764
UniProt Q4VC12
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 460 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger, MYND-Type Containing 17 (ZMYND17) (C-Term) antibody WB Suggested Anti-ZMYND17 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Hosts (6)
Reactivities (6)
Applications (6), (3), (2), (2), (1)
Epitopes (4), (2), (2)
back to top