Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311297

Zinc Finger, MYND-Type Containing 17 (ZMYND17) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4833444M15Rik, Zmynd17, ZMYND17
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311297
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZMYND17 antibody: synthetic peptide directed towards the C terminal of human ZMYND17
Sequence SAHRGLYHDFWEEQVETGQTHHPDLVAAFHPGFHSSPDLM EAWLPTLLLL
Predicted Reactivity Dog : 85%, Bovine : 78%, Horse : 78%, Pig : 78%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against ZMYND17. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZMYND17
Background ZMYND17 contains 1 MYND-type zinc finger. The exact function of ZMYND17 remains unknown.
Molecular Weight 51kDa
Gene ID 118490
NCBI Accession NP_001019764, NM_001024593
UniProt Q4VC12
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZMYND17 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives for antigen "Zinc Finger, MYND-Type Containing 17 (ZMYND17)", type "Antibodies"
Hosts (6)
Reactivities (6)
Applications (6), (3), (3), (2), (2)
Epitopes (5), (2), (2)
Beacon