Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311340

Zinc Finger Protein 340 (ZNF340) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTBD4, BZEL, RINZF, ZNF340, dJ583P15.7, dJ583P15.8, 2610019F01Rik, 4933406L05Rik, Btbd4, btbd4, rinzf, znf340
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311340
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB46 antibody: synthetic peptide directed towards the N terminal of human ZBTB46
Sequence MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGK VFKAHKNVLL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against ZBTB46. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB46
Background ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptional regulation.
Molecular Weight 64kDa
Gene ID 140685
NCBI Accession NP_079500, NM_025224
UniProt Q86UZ6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB46 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kutsenko, Gizatullin, Al-Amin et al.: "NotI flanking sequences: a tool for gene discovery and verification of the human genome." in: Nucleic acids research, Vol. 30, Issue 14, pp. 3163-70, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 340 (ZNF340)", type "Antibodies"
Hosts (22), (2)
Reactivities (23), (12), (12), (12)
Applications (14), (10), (5), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (2), (2), (1), (1)
Beacon