Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 340 (ZNF340) (N-Term) antibody

Details for Product No. ABIN311340
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTBD4, BZEL, RINZF, ZNF340, dJ583P15.7, dJ583P15.8, 2610019F01Rik, 4933406L05Rik, Btbd4, btbd4, rinzf, znf340
Epitope
N-Term
(8), (2), (2), (2), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(29), (12), (12), (12)
Host
Rabbit
(28), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (10), (10), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311340
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZBTB46
Sequence MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGK VFKAHKNVLL
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against ZBTB46. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB46
Background ZBTB46 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. ZBTB46 may be involved in transcriptional regulation.
Molecular Weight 64 kDa
Gene ID 140685
NCBI Accession NM_025224, NP_079500
UniProt Q86UZ6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 589 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 340 (ZNF340) (N-Term) antibody WB Suggested Anti-ZBTB46 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta
Background publications Kutsenko, Gizatullin, Al-Amin et al.: "NotI flanking sequences: a tool for gene discovery and verification of the human genome." in: Nucleic acids research, Vol. 30, Issue 14, pp. 3163-70, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311340
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top