Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311345

Zinc Finger, C3HC-Type Containing 3 (ZCCHC3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2810406K24Rik, C20orf99
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311345
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZCCHC3 antibody: synthetic peptide directed towards the middle region of human ZCCHC3
Sequence RDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAE KLALFLRVYE
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against ZCCHC3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZCCHC3
Background ZCCHC3 contains 3 CCHC-type zinc fingers. The exact function of ZCCHC3 remains unknown.
Molecular Weight 43kDa
Gene ID 85364
NCBI Accession NP_149080, NM_033089
UniProt Q9NUD5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZCCHC3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Alternatives for antigen "Zinc Finger, C3HC-Type Containing 3 (ZCCHC3)", type "Antibodies"
Hosts (4), (2)
Reactivities (6)
Applications (6), (1), (1), (1)
Epitopes (2), (2), (1)
Beacon