Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311450

Zinc Finger Protein 664 (ZNF664) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AW060232, D930038J03Rik, ZFOC1, Znf664, ZNF176
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311450
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF664 antibody: synthetic peptide directed towards the N terminal of human ZNF664
Sequence FFHISELHIHWRDHTGEKVYKCDDCGKDFSTTTKLNRHKK IHTVEKPYKC
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF664. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF664
Background ZNF664 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZNF664 may be involved in transcriptional regulation.
Molecular Weight 30kDa
Gene ID 144348
NCBI Accession NP_689650, NM_152437
UniProt Q8N3J9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF664 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 664 (ZNF664)", type "Antibodies"
Hosts (4)
Reactivities (3), (2)
Applications (4), (1)
Epitopes (2), (1)
Beacon