Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311473

Chromosome 4 Open Reading Frame 33 (C4orf33) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C4H4orf33, MGC108272, MGC197879
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311473
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C4orf33 antibody: synthetic peptide directed towards the C terminal of human C4orf33
Sequence PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFH CLEYFKSFNF
Predicted Reactivity Human : 100%, Dog : 92%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against C4orf33. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C4orf33
Background C4orf33 belongs to the UPF0462 family. The exact function of C4orf33 remains unknown.
Molecular Weight 23kDa
Gene ID 132321
NCBI Accession NP_001093253, NM_001099783
UniProt Q8N1A6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C4orf33 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).

Alternatives for antigen "Chromosome 4 Open Reading Frame 33 (C4orf33)", type "Antibodies"
Hosts (14)
Reactivities (13), (12), (12), (12), (12)
Applications (10), (5), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon