Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1) antibody

Antigen

Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1)
Synonyms GP39, ASRT7, YKL40, YYL-40, HC-gp39, HCGP-3P, FLJ38139, DKFZp686N19119
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Pig (Porcine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311477
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name CHI3L1
Gene ID CHI3L1
UniProt P36222
Immunogen The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1
Sequence LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNT DYAVGYMLRL
Cross-Reactivity Cow (Bovine), Human, Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CHI3L1 antibody concentration is 1 mg/ml.
Description CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
Characteristics Antigen Size: 383 amino acids
Molecular Weight 42kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-CHI3L1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Signaling, Extracellular Matrix, Cancer
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Ober, Tan, Sun et al.: "Effect of variation in CHI3L1 on serum YKL-40 level, risk of asthma, and lung function." in: The New England journal of medicine, Vol. 358, Issue 16, pp. 1682-91, 2008 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1)", type "Antibodies"
Hosts Rabbit (22), Mouse (8)
Reactivities Human (32), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (14), ELISA (12), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes AA 22-383 (3)