DPH2 Homolog (S. Cerevisiae) (DPH2) (N-Term) antibody

Details for Product No. ABIN311481
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Dph2l2, AI467389, 9130020C19Rik, DPH2L2
Epitope
N-Term
(3), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(36), (16), (15), (13), (13), (12)
Host
Rabbit
(22), (16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(29), (10), (10), (7), (6), (6), (5), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN311481
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DPH2
Sequence CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPV VLLSEPACAH
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against DPH2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DPH2
Background This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 52 kDa
Gene ID 1802
NCBI Accession NM_001384, NP_001375
UniProt Q9BQC3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 489 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DPH2 Homolog (S. Cerevisiae) (DPH2) (N-Term) antibody WB Suggested Anti-DPH2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle
Background publications Liu, Milne, Kuremsky et al.: "Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2." in: Molecular and cellular biology, Vol. 24, Issue 21, pp. 9487-97, 2004 (PubMed).

Hosts (22), (16)
Reactivities (36), (16), (15), (13), (13), (12)
Applications (29), (10), (10), (7), (6), (6), (5), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (2), (1), (1)
back to top