Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311481

DPH2 Homolog (S. Cerevisiae) (DPH2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Dph2l2, AI467389, 9130020C19Rik, DPH2L2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311481
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DPH2 antibody: synthetic peptide directed towards the N terminal of human DPH2
Sequence CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPV VLLSEPACAH
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Mouse : 92%, Rat : 91%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against DPH2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DPH2
Background This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 52kDa
Gene ID 1802
NCBI Accession NP_001375, NM_001384
UniProt Q9BQC3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DPH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Liu, Milne, Kuremsky et al.: "Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2." in: Molecular and cellular biology, Vol. 24, Issue 21, pp. 9487-97, 2004 (PubMed).

Alternatives for antigen "DPH2 Homolog (S. Cerevisiae) (DPH2)", type "Antibodies"
Hosts (24), (16)
Reactivities (38), (17), (15), (13), (13), (12)
Applications (31), (13), (10), (7), (6), (6), (5), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (3), (2), (1), (1)
Beacon