Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311491

Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BCKDKD, BDK, AI327402, cb233, zgc:55984, wu:fa04g07, wu:fb80b08, MGC78818, BCKDK
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311491
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-BCKDK antibody: synthetic peptide directed towards the N terminal of human BCKDK
Sequence CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQ YCQLVRQLLD
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Dog : 92%, Horse : 91%
Characteristics This is a rabbit polyclonal antibody against BCKDK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name BCKDK
Background BCKDK belongs to the PDK/BCKDK protein kinase family. It contains 1 histidine kinase domain. BCKDK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCKDK is the key enzyme that regulates the activity state of the BCKD complex.
Molecular Weight 43kDa
Gene ID 10295
NCBI Accession NP_005872, NM_005881
UniProt O14874
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-BCKDK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK)", type "Antibodies"
Hosts (23), (4)
Reactivities (24), (9), (4)
Applications (27), (9), (5), (3), (3), (1), (1)
Epitopes (4), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon