Did you know that you can buy products from over 140 different suppliers from us?

Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK) (N-Term) antibody

Details for Product No. ABIN311491
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms cb233, zgc:55984, wu:fa04g07, wu:fb80b08, MGC78818, BCKDK, AI327402, BCKDKD, BDK
Epitope
N-Term
(10), (7), (7), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(33), (7), (4)
Host
Rabbit
(33), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(37), (20), (6), (4), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311491
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human BCKDK
Sequence CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQ YCQLVRQLLD
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Dog : 90 %, Horse : 90 %
Characteristics This is a rabbit polyclonal antibody against BCKDK. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name BCKDK
Background BCKDK belongs to the PDK/BCKDK protein kinase family. It contains 1 histidine kinase domain. BCKDK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCKDK is the key enzyme that regulates the activity state of the BCKD complex.
Molecular Weight 43 kDa
Gene ID 10295
NCBI Accession NM_005881, NP_005872
UniProt O14874
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 412 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK) (N-Term) antibody WB Suggested Anti-BCKDK Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top