Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK) antibody

Antigen

Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK)

Synonyms AI327402, cb233, zgc:55984, wu:fa04g07, wu:fb80b08, MGC78818, BCKDK, MGC127910
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311491
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name BCKDK
Gene ID BCKDK
UniProt O14874
Immunogen The immunogen for anti-BCKDK antibody: synthetic peptide directed towards the N terminal of human BCKDK
Sequence CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQ YCQLVRQLLD
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-BCKDK antibody concentration is 1 mg/ml.
Description BCKDK belongs to the PDK/BCKDK protein kinase family. It contains 1 histidine kinase domain. BCKDK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCKDK is the key enzyme that regulates the activity state of the BCKD complex.
Characteristics Antigen Size: 412 amino acids
Molecular Weight 43kDa

Application Details

Application Notes WB Suggested Anti-BCKDK Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives

Alternatives for antigen "Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK)", type "Antibodies"
Hosts Rabbit (19), Mouse (1)
Reactivities Human (16), Rat (Rattus) (4), Mouse (Murine) (3)
Applications Western Blotting (WB) (20), ELISA (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Enzyme Immunoassay (EIA) (1), Immunofluorescence (IF) (1), Immunohistochemistry (IHC) (1)
Epitopes N-Term (7), C-Term (5), Center (3), C-Term,Thr340 (1), Internal Region (1)