ADAM Metallopeptidase Domain 7 (ADAM7) antibody

Antigen: ADAM Metallopeptidase Domain 7 (ADAM7)

Synonyms: EAPI, GP-83, ADAM7

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN311605

Additional Information

Alternative name: ADAM7 / GP83

Gene ID: ADAM7

UniProt: Q9H2U9

Immunogen: The immunogen for anti-ADAM7 antibody: synthetic peptide directed towards the C terminal of human ADAM7

Sequence: PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSR GIADPNQSAK

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ADAM7 antibody concentration is 1 mg/ml.

Description: The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 DB077360.1 5-34 31-396 AF215824.1 2-367 397-692 BC058037.1 466-761 693-1666 AF215824.1 664-1637 1667-2321 BC043207.2 1000-1654 2322-2612 AF215824.1 2293-2583

Characteristics: Antigen Size: 754 amino acids

Molecular Weight: 83kDa

Application Details

Application Notes: WB Suggested Anti-ADAM7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ADAM7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Seals, Courtneidge: "The ADAMs family of metalloproteases: multidomain proteins with multiple functions." in: Genes & development, Vol. 17, Issue 1, pp. 7-30, 2003 (PubMed).