Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ATG5 Autophagy Related 5 Homolog (S. Cerevisiae) (ATG5) antibody

Antigen

ATG5 Autophagy Related 5 Homolog (S. Cerevisiae) (ATG5)
Synonyms ASP, APG5, APG5L, hAPG5, APG5-LIKE, apg5l
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311668
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-ATG5 Autophagy Related 5 Homolog (S. Cerevisiae) (ATG5) antibody

anti-ATG5 Autophagy Related 5 Homolog (S. Cerevisiae) (ATG5) antibody (2)

anti-ATG5 Autophagy Related 5 Homolog (S. Cerevisiae) (ATG5) antibody (3)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name APG5L / ATG5
Gene ID ATG5
UniProt Q9H1Y0
Immunogen The immunogen for anti-ATG5 antibody: synthetic peptide directed towards the C terminal of human ATG5
Sequence DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHI SIIPQPTD
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ATG5 antibody concentration is 1 mg/ml.
Description ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.
Characteristics Antigen Size: 275 amino acids
Molecular Weight 32kDa

Application Details
Publications Images Alternatives Variants back to top

Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "ATG5 Autophagy Related 5 Homolog (S. Cerevisiae) (ATG5)", type "Antibodies"
Hosts Rabbit (60), Mouse (17), Chicken (7), Goat (3), Sheep (2)
Reactivities Human (75), Mouse (Murine) (36), Rat (Rattus) (33), Cow (Bovine) (26), Dog (Canine) (21), Pig (Porcine) (21), Chicken (20), Horse (Equine) (19), Fruit Fly (Drosophila melanogaster) (2), Cat (Feline) (1), Rabbit (1)
Applications Western Blotting (WB) (69), ELISA (41), Immunohistochemistry (IHC) (29), Immunofluorescence (IF) (22), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (15), Immunoprecipitation (IP) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Fixed) (IHC (fx)) (1)
Conjugates Biotin (2), HRP (2), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (12), C-Term (7), Internal Region (3), AA 1-50 (2), AA 1-275 (1), AA 218-318 (1), pTyr686 (1)