Did you know that you can buy products from over 140 different suppliers from us?

DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (S. Cerevisiae) (DCUN1D4) (Middle Region) antibody

Details for Product No. ABIN311697
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI836376, RGD1310422, si:ch211-14g4.1
Epitope
Middle Region
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Human, Chicken
(15), (15), (12), (12), (12), (12), (12)
Host
Rabbit
(18)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (8), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN311697
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DCUN1D4
Sequence YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCML GLLLGKIWPL
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against DCUN1D4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DCUN1D4
Background DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.
Molecular Weight 34 kDa
Gene ID 23142
NCBI Accession NM_001040402, NP_001035492
UniProt Q92564
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 292 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (S. Cerevisiae) (DCUN1D4) (Middle Region) antibody WB Suggested Anti-DCUN1D4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (18)
Reactivities (15), (15), (12), (12), (12), (12), (12)
Applications (10), (9), (8), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top