Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311697

DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (S. Cerevisiae) (DCUN1D4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI836376, RGD1310422, si:ch211-14g4.1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311697
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DCUN1D4 antibody: synthetic peptide directed towards the middle region of human DCUN1D4
Sequence YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCML GLLLGKIWPL
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against DCUN1D4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DCUN1D4
Background DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.
Molecular Weight 34kDa
Gene ID 23142
NCBI Accession NP_001035492, NM_001040402
UniProt Q92564
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DCUN1D4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (S. Cerevisiae) (DCUN1D4)", type "Antibodies"
Hosts (18)
Reactivities (15), (15), (12), (12), (12), (12), (12)
Applications (10), (8), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon