Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1) antibody

Antigen: Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1)

Synonyms: TCF3, TCF-3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN404738

Additional Information

Alternative name: TCF7L1

Gene ID: TCF7L1

UniProt: Q9HCS4

Immunogen: The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1

Sequence: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESE NQSSSSDSEA

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TCF7L1 antibody concentration is 1 mg/ml.

Description: TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.

Characteristics: Antigen Size: 588 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-TCF7L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors, Wnt Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-TCF7L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

anti-Transcription Factor 7-Like 1 (T-Cell Specific, HMG-Box) (TCF7L1) antibody (Image 2)

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).