SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) antibody

Antigen: SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A)

Synonyms: FLJ90319, KIAA0700, DKFZp434K2235, SIN3A

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN404805

Additional Information

Alternative name: SIN3A

Gene ID: SIN3A

UniProt: Q96ST3

Immunogen: The immunogen for anti-SIN3A antibody: synthetic peptide directed towards the N terminal of human SIN3A

Sequence: KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVY EAVSETMQSA

Cross-Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SIN3A antibody concentration is 1 mg/ml.

Description: SIN3A is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 1273 amino acids

Molecular Weight: 145kDa

Application Details

Application Notes: WB Suggested Anti-SIN3A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SIN3A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate

anti-SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) antibody (Image 2)

Publications

Product: Zhao, Jankovic, Gural et al.: "Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity." in: Genes & development, Vol. 22, Issue 5, pp. 640-53, 2008 (PubMed).