Homeobox C10 (HOXC10) antibody

Antigen: Homeobox C10 (HOXC10)

Synonyms: HOX3I, MGC5259, Hox-3.6, AI506621, XHoxc10, MGC80182, HOXC10, HOXD10

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN404815

Additional Information

Alternative name: HOXC10 / HOX3I

Gene ID: HOXC10

UniProt: Q9NYD6

Immunogen: The immunogen for anti-HOXC10 antibody: synthetic peptide directed towards the N terminal of human HOXC10

Sequence: GSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQ LDSWGDPKAA

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HOXC10 antibody concentration is 1 mg/ml.

Description: HOXC10 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.

Characteristics: Antigen Size: 342 amino acids

Molecular Weight: 38kDa

Application Details

Application Notes: WB Suggested Anti-HOXC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HOXC10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart

Publications

Product: Zhai, Kuick, Nan et al.: "Gene expression analysis of preinvasive and invasive cervical squamous cell carcinomas identifies HOXC10 as a key mediator of invasion." in: Cancer research, Vol. 67, Issue 21, pp. 10163-72, 2007 (PubMed).